PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0266s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 487aa    MW: 54464.8 Da    PI: 7.3619
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0266s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.45.8e-53932201128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+ +yL+ kv + ++     i+evd++++ePw+Lp  +k +e+ewyfFs rd+ky+tg r+nrat +gyWkatg
  SapurV1A.0266s0070.1.p  93 LPPGFRFHPTDEELIIFYLASKVFNGSFCG-VEIAEVDLNRCEPWELPDVAKMGEREWYFFSLRDRKYPTGLRTNRATGAGYWKATG 178
                             79*************************877.45***************8888899******************************** PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             kd+ev+s+ +g+l g+kktLvfykgrap+gekt+Wvmheyrl
  SapurV1A.0266s0070.1.p 179 KDREVYSAsTGALLGMKKTLVFYKGRAPRGEKTKWVMHEYRL 220
                             ******9878889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-6484242IPR003441NAC domain
PROSITE profilePS5100559.89193242IPR003441NAC domain
PfamPF023653.9E-2794220IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MRPNPSPFSP IHNLALSLIH KHFPILLCFQ CSYKLHARAN HFLSFTPRSQ STILIPIFTT  60
SILCFSLCAR VKMLAMEELL CELSSEGQNE QGLPPGFRFH PTDEELIIFY LASKVFNGSF  120
CGVEIAEVDL NRCEPWELPD VAKMGEREWY FFSLRDRKYP TGLRTNRATG AGYWKATGKD  180
REVYSASTGA LLGMKKTLVF YKGRAPRGEK TKWVMHEYRL DGDLSYRHTC KDEWVICRIF  240
HKKGEKKDVF LQAGQGYHLL EDYSPANSGS LPPLLDASAS LFNQRQLKNK VVDALQNAFL  300
IPEYQENDLK SLQPNPLASP SHVLSINGFQ PSFSPTHIPI SSSAITSTNK STNTNNNDQS  360
PSMLLRSILS DQDCALKEQF GTVSKQWKTE PSFSHDATFG GVDKIINPNP YLNNPLFFEM  420
DCNGNDLGFS GSASAAAAAD TIIHDMSTSI AFSRAGLQTM LDTPFRLPGE SWPSDPQRDF  480
QGPQKH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D4e-519324320169NAC domain-containing protein 19
3swp_C4e-519324320169NAC domain-containing protein 19
3swp_B4e-519324320169NAC domain-containing protein 19
3swp_A4e-519324320169NAC domain-containing protein 19
3swm_D4e-519324320169NAC domain-containing protein 19
3swm_C4e-519324320169NAC domain-containing protein 19
3swm_B4e-519324320169NAC domain-containing protein 19
3swm_A4e-519324320169NAC domain-containing protein 19
4dul_B4e-519324317166NAC domain-containing protein 19
4dul_A4e-519324317166NAC domain-containing protein 19
1ut7_B4e-519324317166NO APICAL MERISTEM PROTEIN
1ut7_A4e-519324317166NO APICAL MERISTEM PROTEIN
1ut4_B4e-519324317166NO APICAL MERISTEM PROTEIN
1ut4_A4e-519324317166NO APICAL MERISTEM PROTEIN
3ulx_A5e-51842456171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011041170.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3 isoform X1
TrEMBLB9H5V70.0B9H5V7_POPTR; Uncharacterized protein
STRINGPOPTR_0005s27720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78883347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.11e-103NAC family protein